PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pavir.2NG543600.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
Family GRAS
Protein Properties Length: 590aa    MW: 62955.9 Da    PI: 9.919
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pavir.2NG543600.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS359.54.8e-1102045722374
                 GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPil 91 
                           +lLl+cAeav+ ++l++a++lL ++ elasp g++ +R+aayf  AL ar+++s  + y+ l+ ++ +  +s +++ a+++++ +sP++
  Pavir.2NG543600.1.p 204 LSLLLRCAEAVAMDQLTEARELLPEIAELASPFGSSPERVAAYFGDALCARVLSSYLGAYSPLALRPLAAAQSRRVAGAFQAYNALSPLV 293
                          689*************************************************************************************** PP

                 GRAS  92 kfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesgskeeleetgerLakfAeelgvpfefnvl 181
                          kfsh+taNqaIl+a++ge+r+H++D+di+qGlQWp L++ LasRp++p slR+Tg+g+    s + le+tg+rLa+fA++lg+pfef+++
  Pavir.2NG543600.1.p 294 KFSHFTANQAILQALDGEDRLHVLDLDIMQGLQWPGLFHILASRPRKPRSLRVTGLGA----SLDVLEATGRRLADFAASLGLPFEFQPI 379
                          **********************************************************....9**************************8 PP

                 GRAS 182 vakrledleleeL.....rvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysa 266
                            k  +  +  +L     r +++Ea++V++++  h l+d ++s       +++l++sl+Pk++++veq++ h s++Fl rf+eal+yysa
  Pavir.2NG543600.1.p 380 EGKIGHVADAAALlgprhRQQQDEATVVHWMH--HCLYDVTGSDVG----TVRLLRSLRPKLITIVEQDLGH-SGDFLGRFVEALHYYSA 462
                          5554455566666555435666*********9..889988999998....**********************.899************** PP

                 GRAS 267 lfdsl.eak...lpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrve 352
                          lfd+l + +   +p+es er+ vEr+llg ei+n+va  g +r+ + + +e+W + l++aGF+pv+l  + a+qa+lll +++++gy++ 
  Pavir.2NG543600.1.p 463 LFDALgD-GagaAPAESAERHAVERQLLGAEIRNIVAVGGPKRTGEVR-VERWGDELRRAGFRPVSLAGSPAAQARLLLGMYPWKGYTLV 550
                          *****63.424478999*************************998887.9**************************************** PP

                 GRAS 353 eesgslvlgWkdrpLvsvSaWr 374
                          e+ ++l lgWkd +L+++SaW+
  Pavir.2NG543600.1.p 551 EDAACLKLGWKDLSLLTASAWE 572
                          *********************5 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098557.571177552IPR005202Transcription factor GRAS
PfamPF035141.6E-107204572IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0048366Biological Processleaf development
GO:0090610Biological Processbundle sheath cell fate specification
GO:0005634Cellular Componentnucleus
Sequence ? help Back to Top
Protein Sequence    Length: 590 aa     Download sequence    Send to blast
MIGNKQGHRR PHTHAHPGRP APVIFFRKPH ASPVPGWRRP CRGPRPSIPP AWPRRQLPAT  60
RQADGRPGAP SLALRTGPRQ ANGEIDPSTL ALGAPQSPAL SVAVPSRLSL ASPRGDRVSD  120
SVALPRNELL PDGAMLQGVL SRAPAPATDA PAAMKAKRAP ASPDEEEDGE GRPARGKRQQ  180
LLGLGSAAAA AAEEGPETRG LRLLSLLLRC AEAVAMDQLT EARELLPEIA ELASPFGSSP  240
ERVAAYFGDA LCARVLSSYL GAYSPLALRP LAAAQSRRVA GAFQAYNALS PLVKFSHFTA  300
NQAILQALDG EDRLHVLDLD IMQGLQWPGL FHILASRPRK PRSLRVTGLG ASLDVLEATG  360
RRLADFAASL GLPFEFQPIE GKIGHVADAA ALLGPRHRQQ QDEATVVHWM HHCLYDVTGS  420
DVGTVRLLRS LRPKLITIVE QDLGHSGDFL GRFVEALHYY SALFDALGDG AGAAPAESAE  480
RHAVERQLLG AEIRNIVAVG GPKRTGEVRV ERWGDELRRA GFRPVSLAGS PAAQARLLLG  540
MYPWKGYTLV EDAACLKLGW KDLSLLTASA WEPAAAAAAP TPRRGSQET*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A6e-492035714374GRAS family transcription factor containing p
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Pvr.48540.0callus| stem
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKJ7269610.0KJ726961.1 Zea mays clone pUT3661 GRAS transcription factor (GRAS54) gene, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004958062.10.0PREDICTED: scarecrow-like protein 23
SwissprotQ9FHZ11e-169SCL23_ARATH; Scarecrow-like protein 23
TrEMBLK4A1090.0K4A109_SETIT; Uncharacterized protein
STRINGSi032551m0.0(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP137138122
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G41920.11e-151GRAS family protein